PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00025097-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 719aa    MW: 80914.2 Da    PI: 5.9199
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00025097-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS323.83.4e-993537132373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        ++Ll+ A+ v+ g+le aqa+Larl++ +sp+g+++qR++ yf+eAL        +++    + s+ s+ + +++++a k fse+sPi+ f+
  PSME_00025097-RA 353 LQQLLDSAKYVELGSLEIAQAILARLNQYVSPRGKALQRATYYFKEALGGL-RP-LQQT---NSKSHLSPLQLVQKINACKNFSEISPIPYFA 440
                       689*********************************************863.22.2344...444555555599******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                       ++taNq +lea+++ +++HiiDfd++ G+QW+++lq++asRp+gpp l +T+vg     ++ e++ ++e+L  fAe+l++pf f+v+   + e
  PSME_00025097-RA 441 NFTANQVLLEALATVDKIHIIDFDMGLGGQWASFLQEIASRPGGPPALTLTAVGY----ESMEMHLIRENLCIFAENLDIPFTFQVVEIPQNE 529
                       *******************************************************....99*************************9999*** PP

              GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                       dl+l++L++k+gE++aVn +l +h ll ++ s++    ++L+l+k+l Pk+vvvv++e +  ++sF+++fleal++y+ lf+slea  + + +
  PSME_00025097-RA 530 DLNLSMLNLKEGETIAVNYSLGMHGLL-SKDSIA----SILHLIKRLYPKIVVVVDHENEQLGSSFAQKFLEALHFYALLFESLEAV-HVNMD 616
                       **************************9.444444....5*********************************************887.67889 PP

              GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrve....eesgslvlgWkdrpLv 368
                       +  ++E+++++++i+nvv ++ ++ + + e+l +Wr+ +++ GF+p+ +s+++ kqa++l r+ +   g+  e    ++++ l+lgW+++ Lv
  PSME_00025097-RA 617 TIEMIEKFVMAPRICNVVEAAYKR-QREGENLPHWRSLFQAQGFTPMMISNFTHKQAESLSRNRQqRFGFCFEavkkQQEQILLLGWQRQVLV 708
                       999****************99985.888899*********************************97889876655544566677********* PP

              GRAS 369 svSaW 373
                       svSaW
  PSME_00025097-RA 709 SVSAW 713
                       ***** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.748326689IPR005202Transcription factor GRAS
PfamPF035141.2E-96353713IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MLDRNTETRP PLLNLKLLQS NGIPAQANNK RTYIRSEYQS EPTSVLDIRS PSPTSTLSVS  60
FGGSTDGGFF RENACDGQLL DCIGVMDSKD GGSWQLQNVI RHDNEFQVTE TETVNVNPNV  120
SLGMEYLENI LLQSPESNHN SQIPCLMGEH FLMGNEYALP GIKAEEAVLQ HTQFNEPTDA  180
QLSEFLCGNP EMNPFTFIGD NVGHALSSFA LSTPSTAVFQ PSSALMTPNI HGPNPHPHSF  240
TPDFKPFKVP MDEKHPELQH PYGANPSYPE KNVVFPMPAA PRGHMGVAHE GFPDFEKSLH  300
WQQMQQREFQ PAWKTMMNRG VREPLFPPVK QEWPLRTHQG KIDMDEVQKS ALLQQLLDSA  360
KYVELGSLEI AQAILARLNQ YVSPRGKALQ RATYYFKEAL GGLRPLQQTN SKSHLSPLQL  420
VQKINACKNF SEISPIPYFA NFTANQVLLE ALATVDKIHI IDFDMGLGGQ WASFLQEIAS  480
RPGGPPALTL TAVGYESMEM HLIRENLCIF AENLDIPFTF QVVEIPQNED LNLSMLNLKE  540
GETIAVNYSL GMHGLLSKDS IASILHLIKR LYPKIVVVVD HENEQLGSSF AQKFLEALHF  600
YALLFESLEA VHVNMDTIEM IEKFVMAPRI CNVVEAAYKR QREGENLPHW RSLFQAQGFT  660
PMMISNFTHK QAESLSRNRQ QRFGFCFEAV KKQQEQILLL GWQRQVLVSV SAWNVNNVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-353527144375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7110550.0KJ711055.1 Pinus tabuliformis clone PtHAM2 HAM2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K0M6Y20.0A0A0K0M6Y2_PINTB; HAM2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.18e-63GRAS family protein